Cilp1 antibody
WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - … Webab251162 is the carrier-free version of ab192881. Our carrier-free antibodies are typically supplied in a PBS-only formulation, purified and free of BSA, sodium azide and glycerol. …
Cilp1 antibody
Did you know?
WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic WebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand.
WebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported. WebCILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensussite(7).TheN-terminalofCILP-1hasbeenshownto bind to and inhibit TGF 1in vitro(8), andCILP1mRNA is induced by TGF 1 (9).
WebJun 1, 2005 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein … WebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding …
WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage.
WebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the … ipad mini screen replacement repairWebOur CILP polyclonal antibodies are developed in Goat and Rabbit. Find the CILP antibody that fits your needs. Choose from 1 of 4 CILP antibodies, which have been validated in … ipad mini shows battery with red lineWebPresident Trump commented on the possibility of a "COVID 4" relief bill and his desire to invest in the country's infrastructure. open one fileWebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ... open onedrive windows 10 on this pcWebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … open one drive with file explorerWebNov 22, 2024 · CILP1 is an extracellular matrix (ECM) protein abundant in articular cartilage 6 and has been implicated in several diseases … ipad mini soft case makerWebPolyclonal Antibody for studying CLIP1/CLIP170. Cited in 5 publications. Validated for Western Blotting. Highly specific and rigorously validated in-house, CLIP1/CLIP170 Antibody (CST #8977) is ready to ship. open one front piece swimsuit